PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.156920.2
Common NameCsa_1G000580, LOC101206845
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 663aa    MW: 73723.3 Da    PI: 7.7345
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.156920.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B357.82e-187713399
                    -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3 33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  Cucsa.156920.2  7 TQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 71
                    35899**********************************************..449999*****996 PP

2Auxin_resp119.23.3e-3996178183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha+st++ F+v+Y+Pr+s+seF+v+++++++++k+++++GmRfkm+fe+e+++e+r++Gt++g +d+dp rW++SkWr+Lk
  Cucsa.156920.2  96 AWHAISTGTLFTVYYKPRTSPSEFIVPYDQYMESIKKSYTIGMRFKMRFEGEEAPEQRFTGTIIGCEDADPKRWKDSKWRCLK 178
                     89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM010192.9E-4172IPR003340B3 DNA binding domain
PROSITE profilePS5086312.619172IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.5E-26285IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.57E-22299IPR015300DNA-binding pseudobarrel domain
CDDcd100172.00E-14570No hitNo description
PfamPF023624.6E-16771IPR003340B3 DNA binding domain
PfamPF065071.6E-3696178IPR010525Auxin response factor
SuperFamilySSF542778.34E-12535614No hitNo description
PROSITE profilePS5174526.111537621IPR000270PB1 domain
PfamPF023091.5E-6584622IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MSRQPPTQEL VAKDLHGNEW RFRHIFRGQP RRHLLQSGWS VFVSSKRLVA GDAFIFLRGE  60
NGELRVGVRR AMRQHGNVPS SVISSHSMHL GVLATAWHAI STGTLFTVYY KPRTSPSEFI  120
VPYDQYMESI KKSYTIGMRF KMRFEGEEAP EQRFTGTIIG CEDADPKRWK DSKWRCLKVR  180
WDETSTISRP EKVSPWKIEP ALAPPALNPL PMTRPKRPRS NMVSTSPDSS VLTREGSSRV  240
TVDPSPASAF TRVLQGQEFS TLRGNFIDGS DPDAAEKSVM WPPSLDDEKV DVVSTSKKHG  300
ADSWIPPGRS EPTYADLLSG FGTDMDSSHG VRAAMGDSAL VTANSIRKHA MEHDGKFSFL  360
GGSSWSVLPS GLSLNLVDSS QKGHIRAGDL SYQVRGNATF NGFGDHSISH CHRTEQPHGN  420
WLMPPPSSHF DYPIHSSELM SKPMLFQNQD ILKPKDGNCK LFGISLVKNP AIPDPVGLNR  480
NMMNEADVMH PNVHQIHSSE SGLKSELPRV LKLDKSVAIS EADKLQQTCK SQGTSARSCT  540
KVHKQGIALG RSVDLSRFNN YDELVAELDQ LFEFGGELQA PKKNWLIVYT DDEGDMMLVG  600
DDPWREFCGM VRKIFIYTRE EVQKMNPGSL NLKGDENPSV EGEEVKETKS QAVPSMSAPE  660
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1011200155354Auxin response factor 1
4ldw_A1e-1011200155354Auxin response factor 1
4ldw_B1e-1011200155354Auxin response factor 1
4ldx_A1e-1011200155354Auxin response factor 1
4ldx_B1e-1011200155354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234080.0KU323408.1 UNVERIFIED: Trichosanthes dioica clone TdARF_6 auxin response factor-like mRNA, partial sequence.
GenBankKU3234220.0KU323422.1 UNVERIFIED: Trichosanthes dioica clone TdARF_30 auxin response factor-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138020.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A0A0LR270.0A0A0A0LR27_CUCSA; Auxin response factor
STRINGVIT_17s0000g00320.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]